A Protein Secondary Structure Prediction Server

Results

After much trouble and strife, Bob the scheduling penguin has retrieved your results! Rejoice. For your pleasure the following viewing options are available. You may bookmark this page for future reference although data is not kept on the server for more than two days.


  • View results summary in SVG - displayed below (details on acronyms used):
    jp_GjJYxvN/1-219Lupas_21Lupas_14Lupas_28jnetpredJNETCONFJNETSOL25JNETSOL5JNETSOL0JNETHMMJNETPSSMJNETJURY
    102030405060708090100110120130140150160170180190200210GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------998319999998852788746899999999862078873211789999999988538864888521010678888742789854787732077566326776541478871353145633001110567761078742177777776407888874058886168874365676368998885320021001433578872688258988614778899-------BB-BB---B----B--BB-BB--B-----BBBBBB-BBBBBBBBBB-BB---BBBBBBBBBBBBBBBBB-BB---BBBBBBBBB--BB--BB-BB--B-----B-BBBB-B--BB--B--------BBBBBBBBB---BB-BBBB--BB-BB--BBBBBBBBBBB-----BB-BB--B--BBB--B-BBBBBB-BBBBBBBBBB-B-------------B---B-----------B--------------B-B----B-BB--BB-------BBBB-B--BBBBBBBB--------BBBB-------------B----------B----B---------------BBBBBB------------B--B-------BBBBBB-BB------B---B----------------BB----BBBBBB--------------------B-----------B------------------------B--BB-------BB-B-------BB-B-----------BB-------------B----------------------------------BBB------------B----------B-BBB-----------------------------------------B----------***********************************
  • View full results in HTML
  • View simple results in HTML
  • View results in PDF
  • View results in Jalview (Link to a separate page with the Jalview Java Desktop application)
  • View everything in a results directory (details on data each file contains are available through README file)
  • Get all (but PS) files in TAR.GZ archive

  • Bob the scheduling penguin

    This Jpred prediction was made with following.

    Jnet version: 2.3.1
    UniRef90 release: 2014_07, 09-Jul-2014

    Primary citation: Drozdetskiy A, Cole C, Procter J & Barton GJ. Nucl. Acids Res.
    (first published online April 16, 2015) doi: 10.1093/nar/gkv332 [link]
    More citations: link.
    .